Anti-NK-1R Rabbit Monoclonal Antibody [clone: ARC1088]
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit monoclonal [ARC1088] antibody to NK-1R for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: NK-1R
Clonality: Monoclonal
Clone: ARC1088
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
Specifications
- Catalog No:
- 77200-860
- Antigen Symbol:
- NK-1R
- Antigen Name:
- Neurokinin 1
- Antigen Synonyms:
- NK-1R|NK1 receptor|NK1R|NKIR|NK 1 receptor|NK 1R|NK1R_HUMAN|NK-1 receptor|Neurokinin 1 Receptor
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC1088
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P25103
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 300-407 of human Neurokinin 1 Receptor (NK1R) (NK1R) (P25103).
- Sequence:
- YNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
- Form:
- Liquid
- Molecular Weight:
- 50 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C
Specifications
Frequently Bought Together