Anti-Menin Rabbit Monoclonal Antibody [clone: ARC1968]
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit monoclonal [ARC1968] antibody to Menin for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: Menin
Clonality: Monoclonal
Clone: ARC1968
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
Specifications
- Catalog No:
- 77232-630
- Antigen Symbol:
- Menin
- Antigen Name:
- MEA 1
- Antigen Synonyms:
- Men1|Menin|Multiple Endocrine Adenomatosis 1|MEN1_HUMAN|SCG 2|MEA1|MEN 1|Multiple Endocrine Neoplasia 1|SCG2
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC1968
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# O00255
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 516-615 of human Menin (O00255).
- Sequence:
- VSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL
- Form:
- Liquid
- Molecular Weight:
- 72 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C
Specifications
Frequently Bought Together