About this item
Rabbit monoclonal [ARC1018] antibody to Tryptophanyl tRNA synthetase/WRS for WB and IHC with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: Tryptophanyl tRNA synthetase/WRS
Clonality: Monoclonal
Clone: ARC1018
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- 77228-548
- Antigen Symbol:
- Tryptophanyl tRNA synthetase/WRS
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC1018
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P23381
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 3-98 of human Tryptophanyl-tRNA synthetase 1 (P23381)
- Sequence:
- NSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGI
- Form:
- Liquid
- Molecular Weight:
- 53 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Tested Applications:
- IHC