Anti-TOMM7 Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to TOMM7 for WB with samples derived from Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:1,000 to 1:5,000
Type: Primary
Antigen: TOMM7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse
- Catalog No:
- 77228-100
- Antigen Symbol:
- TOMM7
- Antigen Name:
- 6.2 kd protein
- Antigen Synonyms:
- TOMM7|Translocase of outer mitochondrial membrane 7 homolog (yeast)|TOM7_HUMAN|Mitochondrial import receptor subunit TOM7 homolog|Translocase of outer membrane 7 kDa subunit homolog|TOM7
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9P0U1
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-55 of human TOMM7 (NP_061932.1)
- Sequence:
- MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
- Form:
- Liquid
- Molecular Weight:
- 11 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
Frequently Bought Together
VWR® Lab Markers
: VWR International
VWR® Broken Glass Disposal Cartons
: VWR International
VWR® Disposable Serological Pipettes
: VWR International
VWR® High-Performance Centrifuge Tubes with Flat or Plug Caps, PP
: VWR International
VWR® Disposable Petri Dishes
: VWR International
PURPLE NITRILE™ and PURPLE NITRILE-XTRA™ Examination Gloves, Kimberly-Clark
: Ansell Healthcare
VWR® Powder-Free Nitrile Examination Gloves
: VWR International
Clorox® Concentrated Germicidal Bleach
: Janitorial Supplies
VWR® Universal Pipette Tips
: VWR International
VWR® Nitrile Examination Gloves, Black
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International