Anti-LXR alpha Rabbit Monoclonal Antibody [clone: ARC0877]
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit monoclonal [ARC0877] antibody to LXR alpha for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: LXR alpha
Clonality: Monoclonal
Clone: ARC0877
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
Specifications
- Catalog No:
- 77227-424
- Antigen Symbol:
- LXR alpha
- Antigen Name:
- Liver X receptor alpha
- Antigen Synonyms:
- NR1H3|LXRA|Oxysterols receptor LXR-alpha|RLD 1|NR1H3_HUMAN|Oxysterols receptor LXR alpha|Nuclear receptor subfamily 1 group H member 3|LXR a|LXR alpha
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC0877
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q13133
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LXRa (Q13133)
- Sequence:
- MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSV
- Form:
- Liquid
- Molecular Weight:
- 50 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Tested Applications:
- IHC, ICC/IF
Specifications
Frequently Bought Together