Order Entry
United States
ContactUsLinkComponent
 
Anti-Mast Cell Chymase Rabbit Polyclonal Antibody
 
undefined
Anti-Mast Cell Chymase Rabbit Polyclonal Antibody

 

  • Catalog No:
  • 76853-478
  • Antigen Symbol:
  • Mast Cell Chymase
  • Antigen Name:
  • Alpha-chymase
  • Antigen Synonyms:
  • Chymase, heart|CYH|chymase 1 preproprotein transcript E|CMA1|Chymase 1|chymase 1 preproprotein transcript I|Chymase, mast cell|Chymase 1 mast cell|CMA1_HUMAN
  • Antibody Type:
  • Primary
  • Clonality:
  • Polyclonal
  • Conjugation:
  • Unconjugated
  • Reactivity:
  • Human, Mouse
  • Host:
  • Rabbit
  • Gene ID:
  • UniprotID# P23946
  • Isotype:
  • IgG
  • Western Blot:
  • Yes
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 247 of human Mast Cell Chymase (CMA1) (NP_001827.1)
  • Sequence:
  • MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
  • Form:
  • Liquid
  • Molecular Weight:
  • 27 kDa
  • Purification:
  • Affinity purification
  • Storage Buffer:
  • Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
  • Storage Temperature:
  • Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
  • Shipping Temperature:
  • Shipped on blue ice at 4 °C

 

Frequently Bought Together