Anti-Mast Cell Chymase Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to Mast Cell Chymase for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: Mast Cell Chymase
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse
- Catalog No:
- 76853-478
- Antigen Symbol:
- Mast Cell Chymase
- Antigen Name:
- Alpha-chymase
- Antigen Synonyms:
- Chymase, heart|CYH|chymase 1 preproprotein transcript E|CMA1|Chymase 1|chymase 1 preproprotein transcript I|Chymase, mast cell|Chymase 1 mast cell|CMA1_HUMAN
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P23946
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 247 of human Mast Cell Chymase (CMA1) (NP_001827.1)
- Sequence:
- MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
- Form:
- Liquid
- Molecular Weight:
- 27 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
Frequently Bought Together