Anti-BPI Rabbit Polyclonal Antibody
About this item
Rabbit polyclonal antibody to BPI for WB with samples derived from Human and Mouse.
- Recommended dilutions: WB: 1:500 to 1:2000
Caution: This product is for research use only. It is not for use in diagnostic or therapeutic procedures.
Type: Primary
Antigen: BPI
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse
1 Options Available Below
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
Rabbit polyclonal antibody to BPI for WB with samples derived from Human and Mouse.
- Recommended dilutions: WB: 1:500 to 1:2000
Caution: This product is for research use only. It is not for use in diagnostic or therapeutic procedures.
Type: Primary
Antigen: BPI
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse
Documents
Specifications for Product Family
Specifications
- Catalog No:
- 76851-700
- 76854-148
- Antigen Symbol:
- BPI
- BPI
- Antigen Name:
- Bactericidal permeability-increasing protein
- Bactericidal permeability-increasing protein
- Antigen Synonyms:
- recombinant BPI holoprotein, rBPI|CAP 57|bactericidal/permeability-increasing protein|BPI|BPIFD1|rBPI|BPI fold containing family D, member 1
- Bactericidal permeability-increasing protein|CAP 57
- Antibody Type:
- Primary
- Primary
- Clonality:
- Polyclonal
- Polyclonal
- Conjugation:
- Unconjugated
- Unconjugated
- Reactivity:
- Human|Mouse
- Human|Mouse
- Host:
- Rabbit
- Rabbit
- Gene ID:
- UniprotID# P17213
- UniprotID# P17213
- Isotype:
- IgG
- IgG
- Western Blot:
- Yes
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 248 - 487 of human BPI (NP_001716.2)
- Recombinant fusion protein containing a sequence corresponding to amino acids 248-487 of human BPI (NP_001716.2)
- Sequence:
- AETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK
- AETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK
- Form:
- Liquid
- Liquid
- Molecular Weight:
- 55 kDa
- 55 kDa
- Purification:
- Affinity purification
- Affinity purification
- Concentration:
- Lot specific
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Supplied in phosphate buffered saline, pH 7.3, with 50% glycerol and 0.02% sodium azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Shipped on blue ice at 4 °C
Specifications
Product Family Options
Product Information
- SizePackagingAvailabilityPrice
- 50 µlPlastic vialDiscontinued-Supplier Number: -Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.Specifications:
More
Specifications
Cat. No.76851-700Antigen SymbolBPIAntigen NameBactericidal permeability-increasing proteinAntigen Synonymsrecombinant BPI holoprotein, rBPI|CAP 57|bactericidal/permeability-increasing protein|BPI|BPIFD1|rBPI|BPI fold containing family D, member 1Antibody TypePrimaryClonalityPolyclonalConjugationUnconjugatedReactivityHuman|MouseHostRabbitGene IDUniprotID# P17213IsotypeIgGWestern BlotYesImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 248 - 487 of human BPI (NP_001716.2)SequenceAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYKFormLiquidMolecular Weight55 kDaPurificationAffinity purificationConcentrationStorage BufferSupplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium AzideStorage TemperatureShipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.Shipping TemperatureShipped on blue ice at 4 °C - Supplier Number: A11825-100Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.Specifications:
More
Specifications
Cat. No.76854-148Antigen SymbolBPIAntigen NameBactericidal permeability-increasing proteinAntigen SynonymsBactericidal permeability-increasing protein|CAP 57Antibody TypePrimaryClonalityPolyclonalConjugationUnconjugatedReactivityHuman|MouseHostRabbitGene IDUniprotID# P17213IsotypeIgGWestern BlotYesImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 248-487 of human BPI (NP_001716.2)SequenceAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYKFormLiquidMolecular Weight55 kDaPurificationAffinity purificationConcentrationLot specificStorage BufferSupplied in phosphate buffered saline, pH 7.3, with 50% glycerol and 0.02% sodium azideStorage TemperatureUpon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.Shipping TemperatureShipped on blue ice at 4 °C
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.



