Anti-ATP1A2 Rabbit Monoclonal Antibody [Clone: ARC2458]
Rabbit monoclonal [ARC2458] antibody to ATP1A2 for WB with samples derived from Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:1,000
Type: Primary
Antigen: ATP1A2
Clonality: Monoclonal
Clone: ARC2458
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse, Rat
- Catalog No:
- 77225-784
- Antigen Symbol:
- ATP1A2
- Antigen Name:
- AT1A2_HUMAN
- Antigen Synonyms:
- ATP1A2|FHM2|Sodium potassium ATPase|MHP2|Na+/K+ ATPase alpha 2 subunit|Sodium pump subunit alpha-2|Na(+)/K(+) ATPase alpha-2 subunit|KIAA0778|Sodium pump subunit alpha 2
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC2458
- Reactivity:
- Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P50993
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP1A2 (P50993).
- Sequence:
- MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSI
- Form:
- Liquid
- Molecular Weight:
- 100 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
Frequently Bought Together
Clorox® Concentrated Germicidal Bleach
: Janitorial Supplies
VWR® Lab Markers
: VWR International
VWR® Broken Glass Disposal Cartons
: VWR International
VWR® Disposable Serological Pipettes
: VWR International
VWR® Disposable Petri Dishes
: VWR International
PURPLE NITRILE™ and PURPLE NITRILE-XTRA™ Examination Gloves, Kimberly-Clark
: Ansell Healthcare
VWR® High-Performance Centrifuge Tubes with Flat or Plug Caps, PP
: VWR International
VWR® Powder-Free Nitrile Examination Gloves
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Nitrile Examination Gloves, Black
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International