Order Entry
United States
ContactUsLinkComponent
Matrix Metalloproteinase-9 Human HEK293, 0.1 mg
Matrix Metalloproteinase-9 Human HEK293, 0.1 mg
Catalog # 103783-170
Supplier:  BioVendor
CAS Number:  
undefined
Matrix Metalloproteinase-9 Human HEK293, 0.1 mg
Catalog # 103783-170
Supplier:  BioVendor
Supplier Number:  RD172439100
CAS Number:  

Specifications

  • Conjugation:
    Unconjugated
  • Protein/Peptide Type:
    Recombinant
  • Source:
    HEK293 cells
  • Species:
    Human
  • Size:
    0.1 mg
  • Storage Conditions:
    Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week
  • Endotoxin Content:
    <0.1 EU/μg
  • Reconstitution Instructions:
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.
  • Protein Synonyms:
    MMP9
  • Protein/Peptide Name:
    Matrix Metalloproteinase-9 Human HEK293
  • Purity:
    >95%
  • Molecular Weight:
    77.2 kDa (calculated)
  • Sequence:
    APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDHHHHHH
  • Endotoxin Level:
    <0.1 EU/μg
  • Formulation:
    Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline pH7.5 + 5% (w/v) Threalose
  • Shipping Temperature:
    At ambient temperature
  • Tested Applications:
    Western blotting, ELISA
  • Cat. No.:
    103783-170

Specifications

About this item

Total 694 AA. MW: 77.2 kDa (calculated). UniProtKB acc. No. P14780 (Ala20–Asp707). C-terminal His-tag (6 AA). Protein identity confirmed by LC-MS/MS.

  • Quality Control Test
  • BCA to determine quantity of the protein
  • SDS PAGE to determine purity of the protein
  • LAL to determine quantity of endotoxin
Caution: Research use only.