Specifications

• Conjugation:
  Unconjugated
• Protein/Peptide Type:
  Recombinant
• Source:
  E. coli
• Species:
  Helicobacter pylori
• Size:
  0.1 mg
• Storage Conditions:
  Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week
• Endotoxin Content:
  <0.1 EU/μg
• Reconstitution Instructions:
  Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
• Protein Synonyms:
  HP-NAP|DNA protection during starvation protein|Bacterioferritin
• Protein/Peptide Name:
  Helicobacter pylori Neutrophil-activating Protein A Helicobacter pylori E. coli
• Purity:
  >95%
• Molecular Weight:
  18.2 kDa (calculated)
• Sequence:
  MKHHHHHHASMKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
• Endotoxin Level:
  <0.1 EU/μg
• Formulation:
  Filtered (0.4 μm) and lyophilized in 20 mM Tris buffer, 50 mM NaCl, pH 7.5
• Shipping Temperature:
  At ambient temperature
• Tested Applications:
  Western blotting, ELISA
• Cat. No.:
  103739-592