Specifications

• Conjugation:
  Unconjugated
• Protein/Peptide Type:
  Recombinant
• Source:
  HEK293 cells
• Species:
  Human
• Size:
  0.1 mg
• Storage Conditions:
  Store the lyophilized protein at −80 °C. Lyophilized protein remains stable until the expiry date when stored at −80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at −80 °C for long term storage. Reconstituted protein can be stored at 4 °C for 5 days
• Endotoxin Content:
  <0.1 EU/μg
• Reconstitution Instructions:
  Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
• Protein Synonyms:
  Secretoglobin family 2A member 2|Mammaglobin-1|SCGB2A2|MGB1|UGB2
• Protein/Peptide Name:
  Mammaglobin A (Fc Chimera) Human HEK293
• Purity:
  >95%
• Molecular Weight:
  36.3 kDa (calculated)
• Sequence:
  GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFKLENLYFQGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Endotoxin Level:
  <0.1 EU/μg
• Formulation:
  Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline, 5% w/v trehalose pH 7.4
• Shipping Temperature:
  At ambient temperature
• Tested Applications:
  Western blotting, ELISA, Cell culture and/or animal studies
• Cat. No.:
  103739-808