Anti-PANP/PILR alpha associated neural protein Rabbit Polyclonal Antibody
Catalog # 103278-668
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Name:PANP/PILR alpha associated neural protein
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:196500
- Antigen Synonyms:PANP|PILR alpha associated neural protein|chromosome 12 open reading frame 53|PIANP|C12orf53
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNR
- Purification:Immunogen affinity purified
- Cat. No.:103278-668
- Supplier no.:NBP1-90541
Specifications
About this item
The PANP / PILR alpha associated neural protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to PANP / PILR alpha associated neural protein. This antibody reacts with human. The PANP / PILR alpha associated neural protein Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: PANP/PILR alpha associated neural protein
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human