Anti-XTP12 Rabbit Polyclonal Antibody
Catalog # 103280-422
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:XTP12
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:81688
- Antigen Synonyms:chromosome 6 open reading frame 62|dJ30M3.2|C6orf62|Nbla00237|HBV X-transactivated protein 12
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS
- Purification:Immunogen affinity purified
- Cat. No.:103280-422
- Supplier no.:NBP1-90534
Specifications
About this item
The XTP12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to XTP12. This antibody reacts with human. The XTP12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: XTP12
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human