Anti-WBSCR16 Rabbit Polyclonal Antibody
Catalog # 103287-104
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:WBSCR16
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:81554
- Antigen Synonyms:Williams-Beuren syndrome chromosomal region 16 protein|RCC1-like G exchanging factor-like protein|MGC44931|Williams-Beuren syndrome chromosome region 16|DKFZp434D0421|MGC189739
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against a recombinant protein corresponding to amino acids: TLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVEN
- Purification:Immunogen affinity purified
- Cat. No.:103287-104
- Supplier no.:NBP2-31833
Specifications
About this item
The WBSCR16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WBSCR16. This antibody reacts with human. The WBSCR16 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: WBSCR16
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human