Anti-U2AF2 Mouse Monoclonal Antibody [clone: 5G8]
Catalog # 103340-600
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Name:U2 small nuclear RNA auxiliary factor 2
- Antigen Symbol:U2AF2
- Clonality:Monoclonal
- Clone:5G8
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG1 kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 µg
- Cross Adsorption:No
- Format:Liquid
- Gene ID:11338
- Antigen Synonyms:U2AF65
- Amino Acid Number:141 to 240
- Storage Buffer:1X PBS, pH 7,4
- Sequence:GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:U2AF2 (NP_001012496.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Purification:IgG purified
- Cat. No.:103340-600
- Supplier no.:H00011338-M03
Specifications
About this item
The U2AF2 Antibody (5G8) from Novus Biologicals is a mouse monoclonal antibody to U2AF2. This antibody reacts with human. The U2AF2 Antibody (5G8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence.
Recommended Dilutions: Western Blot: 1 to 5 µg/ml.
Type: Primary
Antigen: U2AF2
Clonality: Monoclonal
Clone: 5G8
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human