Anti-TSSC1 Rabbit Polyclonal Antibody
103272-280
- Antibody Type:Primary
- Antigen Symbol:TSSC1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:7260
- Antigen Synonyms:protein TSSC1|tumor suppressing subtransferable candidate 1|Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein|Tumor-suppressing STF cDNA 1 protein
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:VILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSVYAVDWSSADPWLFASLSYDGRLVINRVPRALKYH
- Purification:Immunogen affinity purified
- Cat. No.:103272-280
- Supplier no.:NBP1-85927
The TSSC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSSC1. This antibody reacts with human. The TSSC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: TSSC1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human