Anti-TMEM133 Rabbit Polyclonal Antibody
103287-096
- Antibody Type:Primary
- Antigen Symbol:TMEM133
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:83935
- Antigen Synonyms:AD031|MGC138255|transmembrane protein 133
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against a recombinant protein corresponding to amino acids: MTSHHCVGPGNHISWSGHEKEHRLDYCPEVTF
- Purification:Immunogen affinity purified
- Cat. No.:103287-096
- Supplier no.:NBP2-31829
The TMEM133 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM133. This antibody reacts with human. The TMEM133 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: TMEM133
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human