Anti-SLC6A14 Rabbit Polyclonal Antibody
Catalog # 103272-886
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:SLC6A14
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:11254
- Antigen Synonyms:member 14|Amino acid transporter ATB0+|OBX|solute carrier family 6 (neurotransmitter transporter)|solute carrier family 6 (amino acid transporter)|sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)|BMIQ11|amino acid transporter B0+|Solute carrier family 6 member 14
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
- Purification:Immunogen affinity purified
- Cat. No.:103272-886
- Supplier no.:NBP1-86521
Specifications
About this item
The SLC6A14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC6A14. This antibody reacts with human. The SLC6A14 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: SLC6A14
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human