Anti-SAP130 Rabbit Polyclonal Antibody
Catalog # 103284-212
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:SAP130
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western Blot:Yes
- Size:100 μl
- Gene ID:23450
- Antigen Synonyms:SAP130SAP 130|splicing factor 3B subunit 3|SF3b130pre-mRNA splicing factor SF3b|130 kDa subunit|splicing factor 3b|Spliceosome-associated protein 130|subunit 3|KIAA0017splicing factor 3b|130kD|Pre-mRNA-splicing factor SF3b 130 kDa subunit|130kDa|STAF130|SF3B130|RSE1
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:DTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFC
- Purification:Immunogen affinity purified
- Cat. No.:103284-212
- Supplier no.:NBP1-92362
Specifications
About this item
The SAP130 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAP130. This antibody reacts with human, mouse, rat. The SAP130 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: SAP130
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat