Anti-RyR1 Rabbit Polyclonal Antibody
103286-718
- Antibody Type:Primary
- Antigen Name:Ryanodine Receptor 1
- Antigen Symbol:RyR1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:6261
- Antigen Synonyms:Skeletal muscle-type ryanodine receptor|RYR|CCO|RYR-1|ryanodine receptor 1 (skeletal)|SKRR|RYDR|sarcoplasmic reticulum calcium release channel|Skeletal muscle calcium release channel|type 1-like ryanodine receptor|MHS1|ryanodine receptor type1|ryanodine receptor 1|RyR1|skeletal muscle ryanodine receptor|MHS|central core disease of muscle
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against a recombinant protein corresponding to amino acids: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK
- Purification:Immunogen affinity purified
- Cat. No.:103286-718
- Supplier no.:NBP2-33785
The Ryanodine Receptor 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ryanodine Receptor 1. This antibody reacts with human. The Ryanodine Receptor 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: RyR1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human