Anti-RUVBL1 Rabbit Polyclonal Antibody
Catalog # 103268-776
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:RUVBL1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:8607
- Antigen Synonyms:PONTIN|TIH1|INO80HTIP49A|54 kDa erythrocyte cytosolic protein|TATA binding protein interacting protein 49 kDa|TIP60-associated protein 54-alpha|EC 3.6.4.12,49 kDa TBP-interacting protein|RuvB (E coli homolog)-like 1|TIP49a|RuvB-like 1 (E. coli)|INO80 complex subunit H|TIP49TAP54-alpha|ECP54|ruvB-like 1|NMP238ECP-54|EC 3.6.1|Pontin52|NMP 238|RVB1|Nuclear matrix protein 238|49 kDa TATA box-binding protein-interacting protein|Pontin 52
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG
- Purification:Immunogen affinity purified
- Cat. No.:103268-776
- Supplier no.:NBP1-84913
Specifications
About this item
The RUVBL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RUVBL1. This antibody reacts with human. The RUVBL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: RUVBL1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human