Anti-RAB11FIP3 Rabbit Polyclonal Antibody
Catalog # 103266-578
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:RAB11FIP3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:9727
- Antigen Synonyms:RAB11 family interacting protein 3 (class II)|PAC196A12.1|rab11-family interacting protein 3|FIP3-Rab11|MU-MB-17.148|ARFO1|Eferin|Rab11-FIP3rab11 family-interacting protein 3|Arfophilin-1|EF hands-containing Rab-interacting protein|KIAA0665arfophilin-1
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:QVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETF
- Purification:Immunogen affinity purified
- Cat. No.:103266-578
- Supplier no.:NBP1-83998
Specifications
About this item
The RAB11FIP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB11FIP3. This antibody reacts with human. The RAB11FIP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: RAB11FIP3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human