Anti-PRPF40B Rabbit Polyclonal Antibody
Catalog # 103284-938
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:PRPF40B
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:25766
- Antigen Synonyms:PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae)
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:PQPQPDPPPVPPGPTPVPTGLLEPEPGGSEDCDVLEATQPLEQGFLQQLEEGPSSSGQHQPQQEEEESKPEPERSGLSWSNREKAKQAF
- Purification:Immunogen affinity purified
- Cat. No.:103284-938
- Supplier no.:NBP1-93680
Specifications
About this item
The PRPF40B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRPF40B. This antibody reacts with human. The PRPF40B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: PRPF40B
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human