Anti-PEX5 Rabbit Polyclonal Antibody
Catalog # 103270-430
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:PEX5
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western Blot:Yes
- Size:100 μl
- Gene ID:5830
- Antigen Synonyms:peroxisomal biogenesis factor 5|Peroxin-5|Peroxisomal C-terminal targeting signal import receptor|FLJ50721|Peroxisome receptor 1peroxin-5|PTS1-BP|PTS1RFLJ51948|peroxisomal targeting signal receptor 1|peroxisomal targeting signal 1 receptor|PTS1 receptor|FLJ50634|PXR1peroxisomal targeting signal 1 (SKL type) receptor|peroxisomal targeting signal import receptor
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
- Purification:Immunogen affinity purified
- Cat. No.:103270-430
- Supplier no.:NBP1-87185
Specifications
About this item
The PEX5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PEX5. This antibody reacts with human, mouse, rat. The PEX5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: PEX5
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat