Anti-PDLIM7 Rabbit Polyclonal Antibody
103260-730
- Antibody Type:Primary
- Antigen Symbol:PDLIM7
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:9260
- Antigen Synonyms:LMP1|PDZ and LIM domain 7 (enigma)|PDZ and LIM domain protein 7|LMP|LIM mineralization protein|LIM domain protein|1110003B01Rik|ENIGMAProtein enigma
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:HLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTR
- Purification:Immunogen affinity purified
- Cat. No.:103260-730
- Supplier no.:NBP1-84841
The PDLIM7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDLIM7. This antibody reacts with human. The PDLIM7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: PDLIM7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human