Anti-PDE7A Rabbit Polyclonal Antibody
103267-554
- Antibody Type:Primary
- Antigen Symbol:PDE7A
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:5150
- Antigen Synonyms:phosphodiesterase isozyme 7|PDE7|EC 3.1.4|HCP1high affinity cAMP-specific 3'-5'-cyclic phosphodiesterase 7A|phosphodiesterase 7A|TM22|EC 3.1.4.17
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:FMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS
- Purification:Immunogen affinity purified
- Cat. No.:103267-554
- Supplier no.:NBP1-83275
The PDE7A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDE7A. This antibody reacts with human. The PDE7A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: PDE7A
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human