Anti-OR1I1 Mouse Monoclonal Antibody [clone: 1G6]
Catalog # 103346-652
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Name:Olfactory Receptor, Family 1, Subfamily I Member 1
- Antigen Symbol:OR1I1
- Clonality:Monoclonal
- Clone:1G6
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Cross Adsorption:No
- Format:Liquid
- Gene ID:126370
- Antigen Synonyms:OR1I1Q|family 1|olfactory receptor 1I1|subfamily I|Olfactory receptor 19-20|member 1|olfactory receptor|OR19-20OR1I1P
- Amino Acid Number:293 - 355
- Storage Buffer:PBS (pH 7.4)
- Sequence:RNKDMKAALGKLIGKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME
- Storage Temperature:Aliquot and store at −20 °C or −80 °C. Avoid freeze-thaw cycles.
- Immunogen:OR1I1 (NP_001004713.1, 293 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Purification:IgG purified
- Cat. No.:103346-652
- Supplier no.:H00126370-M04
Specifications
About this item
The OR1I1 Antibody (1G6) from Novus Biologicals is a mouse monoclonal antibody to OR1I1. This antibody reacts with human. The OR1I1 Antibody (1G6) has been validated for the following applications: Western Blot, ELISA.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: OR1I1
Clonality: Monoclonal
Clone: 1G6
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human