Anti-Lactalbumin Rabbit Polyclonal Antibody
Catalog # 103270-758
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Name:Lactalbumin
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:3906
- Antigen Synonyms:LYZL7|MGC138523|Lactose synthase B protein|lactalbumin|MGC138521|alpha-lactalbumin|alpha-|Lysozyme-like protein 7
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:QVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEK
- Purification:Immunogen affinity purified
- Cat. No.:103270-758
- Supplier no.:NBP1-87715
Specifications
About this item
The Lactalbumin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lactalbumin. This antibody reacts with human. The Lactalbumin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: Lactalbumin
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human