Anti-MKP-1/DUSP1 Mouse Monoclonal Antibody [clone: 3A9]
103325-350
- Antibody Type:Primary
- Antigen Symbol:MKP-1/DUSP1
- Clonality:Monoclonal
- Clone:3A9
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG2b kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Gene ID:1843
- Antigen Synonyms:dual specificity phosphatase 1|Mitogen-activated protein kinase phosphatase 1|HVH1|Dual specificity protein phosphatase hVH1|VH1|CL100MAP kinase phosphatase 1|MKP-1dual specificity protein phosphatase 1|Protein-tyrosine phosphatase CL100|MKP1|EC 3.1.3.16|PTPN10serine/threonine specific protein phosphatase|EC 3.1.3.48
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:DUSP1 (NP_004408 305 a.a. - 367 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
- Purification:IgG purified
- Cat. No.:103325-350
- Supplier no.:H00001843-M05
The MKP-1 / DUSP1 Antibody (3A9) from Novus Biologicals is a mouse monoclonal antibody to MKP-1 / DUSP1. This antibody reacts with human. The MKP-1 / DUSP1 Antibody (3A9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence.
Type: Primary
Antigen: MKP-1/DUSP1
Clonality: Monoclonal
Clone: 3A9
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human