Anti-MARK2 Rabbit Polyclonal Antibody
Catalog # 103266-890
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:MARK2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:2011
- Antigen Synonyms:ELKL motif kinase 1|serine/threonine-protein kinase MARK2|EMK-1|PAR1 homolog|EMK1PAR-1|Par1b|ELKL motif kinase|EC 2.7.11.1|Ser/Thr protein kinase PAR-1B|EC 2.7.11|MAP/microtubule affinity-regulating kinase 2MGC99619|serine/threonine protein kinase EMK
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
- Purification:Immunogen affinity purified
- Cat. No.:103266-890
- Supplier no.:NBP1-84848
Specifications
About this item
The MARK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARK2. This antibody reacts with human. The MARK2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: MARK2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human