Anti-LMBR1 Rabbit Polyclonal Antibody
Catalog # 103271-688
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:LMBR1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:64327
- Antigen Synonyms:ACHPchromosome 7 open reading frame 2|TPT|C7orf2FLJ11665|limb region 1 homolog (mouse)|Differentiation-related gene 14 protein|PPD2|DIF14|limb region 1 protein homolog
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN
- Purification:Immunogen affinity purified
- Cat. No.:103271-688
- Supplier no.:NBP1-89276
Specifications
About this item
The LMBR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LMBR1. This antibody reacts with human. The LMBR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: LMBR1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human