Anti-HSD17B7 Rabbit Polyclonal Antibody
Catalog # 103286-380
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:HSD17B7
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:51478
- Antigen Synonyms:hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase|EC 1.1.1.62|SDR37C1|MGC12523|17-beta-hydroxysteroid dehydrogenase 7|short chain dehydrogenase/reductase family 37C|member 1|3-keto-steroid reductase|EC 1.1.1.270|PRAP|Estradiol 17-beta-dehydrogenase 7|MGC75018,17-beta-HSD 7|17 beta-hydroxysteroid dehydrogenase type VII
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids: ANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMD LDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSC
- Purification:Immunogen affinity purified
- Cat. No.:103286-380
- Supplier no.:NBP2-14102
Specifications
About this item
The HSD17B7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD17B7. This antibody reacts with human. The HSD17B7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: HSD17B7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human