To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Symbol:HCLS1
- Clonality:Monoclonal
- Clone:1A8
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoChemistry:Yes
- Isotype:IgG1 kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:3059
- Antigen Synonyms:p75|LckBP1|CTTNL|HS1lckBP1|hematopoietic cell-specific Lyn substrate 1hematopoietic lineage cell-specific protein
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:HCLS1 (AAH16758, 266 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
- Tested Applications:Proximity Ligation Assay, RNA Inhibition
- Purification:IgG purified
- Cat. No.:103327-910
- Supplier no.:H00003059-M02
The HCLS1 Antibody (1A8) from Novus Biologicals is a mouse monoclonal antibody to HCLS1. This antibody reacts with human. The HCLS1 Antibody (1A8) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin, Proximity Ligation Assay, RNA Inhibition.
Type: Primary
Antigen: HCLS1
Clonality: Monoclonal
Clone: 1A8
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human