Anti-HCLS1 Mouse Monoclonal Antibody [clone: 3F4]
Catalog # 103327-914
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:HCLS1
- Clonality:Monoclonal
- Clone:3F4
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoChemistry:Yes
- Isotype:IgG1 kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Gene ID:3059
- Antigen Synonyms:p75|LckBP1|CTTNL|HS1lckBP1|hematopoietic cell-specific Lyn substrate 1hematopoietic lineage cell-specific protein
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:HCLS1 (AAH16758, 266 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
- Purification:IgG purified
- Cat. No.:103327-914
- Supplier no.:H00003059-M04
Specifications
About this item
The HCLS1 Antibody (3F4) from Novus Biologicals is a mouse monoclonal antibody to HCLS1. This antibody reacts with human. The HCLS1 Antibody (3F4) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: HCLS1
Clonality: Monoclonal
Clone: 3F4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human