Anti-Corneodesmosin Mouse Monoclonal Antibody [clone: 6F11]
Catalog # 103323-760
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Name:Corneodesmosin
- Clonality:Monoclonal
- Clone:6F11
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Gene ID:1041
- Antigen Synonyms:HTSS|S|S protein|corneodesmosin|differentiated keratinocyte S protein|D6S586E
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:CDSN (NP_001255 306 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
- Purification:IgG purified
- Cat. No.:103323-760
- Supplier no.:H00001041-M01
Specifications
About this item
The Corneodesmosin Antibody (6F11) from Novus Biologicals is a mouse monoclonal antibody to Corneodesmosin. This antibody reacts with human. The Corneodesmosin Antibody (6F11) has been validated for the following applications: Western Blot, ELISA.
Type: Primary
Antigen: Corneodesmosin
Clonality: Monoclonal
Clone: 6F11
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human