Anti-GEFT Rabbit Polyclonal Antibody
Catalog # 103286-616
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:GEFT
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:115557
- Antigen Synonyms:Rac/Cdc42/Rho exchange factor GEFT|Guanine nucleotide exchange factor GEFT|RhoA/RAC/CDC42 exchange factor|Rho guanine nucleotide exchange factor (GEF) 25|RhoA/Rac/Cdc42 guanine nucleotide exchange factor GEFT|GEFTRAC/CDC42 exchange factor|p63RhoGEFrho guanine nucleotide exchange factor 25
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids: HSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGD KTQPPEEETLSQAPESEEEQKKKALERSMYV
- Purification:Immunogen affinity purified
- Cat. No.:103286-616
- Supplier no.:NBP2-14309
Specifications
About this item
The GEFT Antibody from Novus Biologicals is a rabbit polyclonal antibody to GEFT. This antibody reacts with human. The GEFT Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: GEFT
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human