Anti-FKBP12.6 Mouse Monoclonal Antibody [clone: 4H5-1B6]
Catalog # 103326-482
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:FKBP12.6
- Clonality:Monoclonal
- Clone:4H5-1B6
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Gene ID:2281
- Antigen Synonyms:FKBP-1B|FK506-binding protein 12.6|FK506-binding protein 1B|FKBP1L|12.6 kDa|OTK4PPIase FKBP1B|FK506-binding protein 1B (12.6 kD)|EC 5.2.1.8|Immunophilin FKBP12.6|FKBP12.6h-FKBP-12|Rotamase|FK506 binding protein 1B|FKBP9|12.6 kDa FK506-binding protein|calstabin 2,12.6 kDa FKBP|peptidyl-prolyl cis-trans isomerase FKBP1B|FKBP-12.6|PKBP1L|PPIase
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:FKBP1B (AAH02614, 1 a.a. - 80 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
- Purification:IgG purified
- Cat. No.:103326-482
- Supplier no.:H00002281-M01
Specifications
About this item
The FKBP12.6 Antibody (4H5-1B6) from Novus Biologicals is a mouse monoclonal antibody to FKBP12.6. This antibody reacts with human. The FKBP12.6 Antibody (4H5-1B6) has been validated for the following applications: Western Blot, ELISA.
Type: Primary
Antigen: FKBP12.6
Clonality: Monoclonal
Clone: 4H5-1B6
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human