Anti-FIP1/RCP Rabbit Polyclonal Antibody
Catalog # 103259-284
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:FIP1/RCP
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:80223
- Antigen Synonyms:EC 6.1.1.7|Rab11-FIP1|Rab-coupling protein|RAB11 family interacting protein 1 (class I)|rab11 family-interacting protein 1|Rab-interacting recycling protein|FLJ22524|FLJ22622|NOEL1A|DKFZp686E2214|EC 3.2.1.28|MGC78448|RCPRab effector protein|RAB11 coupling protein
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR
- Purification:Immunogen affinity purified
- Cat. No.:103259-284
- Supplier no.:NBP1-83599
Specifications
About this item
The FIP1 / RCP Antibody from Novus Biologicals is a rabbit polyclonal antibody to FIP1 / RCP. This antibody reacts with human. The FIP1 / RCP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: FIP1/RCP
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human