Anti-EXOC6 Rabbit Polyclonal Antibody
103271-782
- Antibody Type:Primary
- Antigen Symbol:EXOC6
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human,Mouse
- Western Blot:Yes
- Size:100 μl
- Gene ID:54536
- Antigen Synonyms:MGC33397|Exocyst complex component Sec15A|FLJ11251|SEC15L3|EXOC6A|exocyst complex component 6|FLJ1125|SEC15-like protein 1|SEC15-like 1|SEC15LSEC15|DKFZp761I2124|SEC15L1SEC15-like 1 (S. cerevisiae)|Sec15p|SEC15-like protein 3|SEC15A
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
- Purification:Immunogen affinity purified
- Cat. No.:103271-782
- Supplier no.:NBP1-85031
The EXOC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EXOC6. This antibody reacts with human, mouse. The EXOC6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: EXOC6
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse