Anti-EVA1/MPZL2 Rabbit Polyclonal Antibody
103287-110
- Antibody Type:Primary
- Antigen Symbol:EVA1/MPZL2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:10205
- Antigen Synonyms:myelin protein zero-like 2|EVAEpithelial V-like antigen 1EVA1myelin protein zero-like protein 2
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against a recombinant protein corresponding to amino acids: VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ
- Purification:Immunogen affinity purified
- Cat. No.:103287-110
- Supplier no.:NBP2-31836
The EVA1 / MPZL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EVA1 / MPZL2. This antibody reacts with human. The EVA1 / MPZL2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: EVA1/MPZL2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human