Anti-DDX3Y Mouse Monoclonal Antibody [clone: 2D7]
Catalog # 103335-366
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:DDX3Y
- Clonality:Monoclonal
- Clone:2D7
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoChemistry:Yes
- Isotype:IgG1 kappa
- Reactivity:Human,Mouse
- Western Blot:Yes
- Size:100 μg
- Gene ID:8653
- Antigen Synonyms:ATP-dependent RNA helicase DDX3Y|Y-linked|Y-chromosomal|Y chromosome|DBYEC 3.6.4.13|DEAD (Asp-Glu-Ala-Asp) box polypeptide 3|EC 3.6.1|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide|DEAD box protein 3
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:DDX3Y (NP_004651, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK
- Purification:IgG purified
- Cat. No.:103335-366
- Supplier no.:H00008653-M01
Specifications
About this item
The DDX3Y Antibody (2D7) from Novus Biologicals is a mouse monoclonal antibody to DDX3Y. This antibody reacts with human, mouse. The DDX3Y Antibody (2D7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: DDX3Y
Clonality: Monoclonal
Clone: 2D7
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human, Mouse