Anti-COQ3 Rabbit Polyclonal Antibody
Catalog # 103275-228
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:COQ3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:51805
- Antigen Synonyms:UG0215E05|DHHB-MTase|hexaprenyldihydroxybenzoate methyltransferase|methyltransferase (yeast)|bA9819.1|DHHBMT|methyltransferase COQ3|3-demethylubiquinone-10 3-methyltransferase|EC 2.1.1|EC 2.1.1.64|methyltransferase (S. cerevisiae)|DHHBMTASE|mitochondrial3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase|DHHB-MT|coenzyme Q3 homolog|DHHB methyltransferase|EC 2.1.1.114|Dihydroxyhexaprenylbenzoate methyltransferase
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV
- Purification:Immunogen affinity purified
- Cat. No.:103275-228
- Supplier no.:NBP1-88725
Specifications
About this item
The COQ3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COQ3. This antibody reacts with human. The COQ3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: COQ3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human