Anti-CLCN7 Rabbit Polyclonal Antibody
103279-354
- Antibody Type:Primary
- Antigen Symbol:CLCN7
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:1186
- Antigen Synonyms:OPTB4|OPTA2FLJ46423|CLC7FLJ39644|H(+)/Cl(-) exchange transporter 7|chloride channel 7|CLC-7|FLJ26686|Chloride channel protein 7
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVT
- Purification:Immunogen affinity purified
- Cat. No.:103279-354
- Supplier no.:NBP1-91792
The CLCN7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLCN7. This antibody reacts with human. The CLCN7 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: CLCN7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human