Anti-CD63 Rabbit Polyclonal Antibody
100 μl
Catalog # 103266-948
Marketsource
Supplier: Novus Biologicals
Supplier #: NBP1-82784
Jump to:
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
The CD63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD63. This antibody reacts with human. The CD63 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: CD63
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
Specifications
- Size:100 μl
- Clonality:Polyclonal
- Purification:Immunogen affinity purified
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Isotype:IgG
- Host:Rabbit
- Cat. No.:103266-948
- Reactivity:Human
- Antibody Type:Primary
- Antigen Symbol:CD63
- Gene ID:967
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG
- ImmunoChemistry:Yes
- Conjugation:Unconjugated
- Antigen Synonyms:tspan-30|Ocular melanoma-associated antigen|OMA81H|Melanoma-associated antigen ME491|melanoma 1 antigen|Lysosomal-associated membrane protein 3|CD63 molecule|MLA1lysosome-associated membrane glycoprotein 3|TSPAN30granulophysin|Tetraspanin-30|ME491|Granulophysin|LAMP-3|melanoma-associated antigen MLA1|CD63 antigen (melanoma 1 antigen)|CD63 antigen
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Recommendations
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.



