Anti-Adenylate Cyclase 2 Rabbit Polyclonal Antibody
Catalog # 103277-728
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Name:Adenylate Cyclase 2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:108
- Antigen Synonyms:MGC133314|FLJ45092|Adenylate cyclase type II|adenylate cyclase 2 (brain)|AC2|type II adenylate cyclase|adenylate cyclase type 2|Adenylyl cyclase 2|KIAA1060FLJ16822|HBAC2|EC 4.6.1.1|3'-5'-cyclic AMP synthetase|ATP pyrophosphate-lyase 2|adenylate cyclase II
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK
- Purification:Immunogen affinity purified
- Cat. No.:103277-728
- Supplier no.:NBP1-90280
Specifications
About this item
The Adenylate Cyclase 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Adenylate Cyclase 2. This antibody reacts with human. The Adenylate Cyclase 2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: Adenylate Cyclase 2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human