Anti-CCL1/I-309/TCA-3 Mouse Monoclonal Antibody [clone: 4E4.]
Catalog # 103309-864
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:CCL1/I-309/TCA-3
- Clonality:Monoclonal
- Clone:4E4.
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2b kappa
- Reactivity:Human
- Size:100 μg
- Gene ID:6346
- Antigen Synonyms:TCA3|SISe|C-C motif chemokine 1|small inducible cytokine A1 (I-309|SCYA1Small-inducible cytokine A1|homologous to mouse Tca-3)|inflammatory cytokine I-309|T lymphocyte-secreted protein I-309|chemokine (C-C motif) ligand 1|P500|I-309
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:CCL1 (NP_002972, 24 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
- Purification:IgG purified
- Cat. No.:103309-864
- Supplier no.:H00006346-M02
Specifications
About this item
The CCL1 / I-309 / TCA-3 Antibody (4E4.) from Novus Biologicals is a mouse monoclonal antibody to CCL1 / I-309 / TCA-3. This antibody reacts with human. The CCL1 / I-309 / TCA-3 Antibody (4E4.) has been validated for the following applications: ELISA.
Type: Primary
Antigen: CCL1/I-309/TCA-3
Clonality: Monoclonal
Clone: 4E4.
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human