Anti-CCDC14 Rabbit Polyclonal Antibody
Catalog # 103268-466
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:CCDC14
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:64770
- Antigen Synonyms:FLJ12892|DKFZp434L1050|coiled-coil domain containing 14
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:IIYQALCEHVQTQMSLMNDLTSKNIPNGIPAVPCHAPSHSESQATPHSSYGLCTSTPVWSLQRPPCPPKVHSEVQTDGNSQFASQG
- Purification:Immunogen affinity purified
- Cat. No.:103268-466
- Supplier no.:NBP1-84183
Specifications
About this item
The CCDC14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC14. This antibody reacts with human. The CCDC14 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: CCDC14
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human