Anti-C6orf120 Rabbit Polyclonal Antibody
Catalog # 103275-378
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:C6orf120
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:387263
- Antigen Synonyms:bA160E12.4|hypothetical protein LOC387263|chromosome 6 open reading frame 120
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:PEEWVLLHVVQGQIGAGNYSYLRLNHEGKIVLRMRSLKGDADLYVSASSLHPSFDDYELQSATCGPDAVSIPAHFRRPVGIGVYGH
- Purification:Immunogen affinity purified
- Cat. No.:103275-378
- Supplier no.:NBP1-88979
Specifications
About this item
The C6orf120 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C6orf120. This antibody reacts with human. The C6orf120 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: C6orf120
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human