To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:ATP7b
- Clonality:Monoclonal
- Clone:3E10.
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Gene ID:540
- Antigen Synonyms:PWD|EC 3.6.3.4|beta polypeptide (Wilson disease)|Cu++ transporting|copper-transporting ATPase 2|EC 3.6.3|beta polypeptide|Wilson disease-associated protein|WD|Cu(2+)- transporting|ATPase|WNDATPase|Copper pump 2|WC1
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:ATP7B (NP_000044, 1372 a.a. - 1465 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
- Purification:IgG purified
- Cat. No.:103322-440
- Supplier no.:H00000540-M01
Specifications
About this item
The ATP7b Antibody (3E10.) from Novus Biologicals is a mouse monoclonal antibody to ATP7b. This antibody reacts with human. The ATP7b Antibody (3E10.) has been validated for the following applications: Western Blot, ELISA.
Type: Primary
Antigen: ATP7b
Clonality: Monoclonal
Clone: 3E10.
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human