To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:5-HT1E
- Clonality:Monoclonal
- Clone:2E9.
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:3354
- Antigen Synonyms:Serotonin receptor 1E|S31,5-HT1E5-hydroxytryptamine receptor 1E|5-HT-1E|5-hydroxytryptamine (serotonin) receptor 1E
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:HTR1E (NP_000856.1 206 a.a. - 276 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG
- Purification:Protein A purified
- Cat. No.:103328-656
- Supplier no.:H00003354-M03
Specifications
About this item
The 5-HT1E Antibody (2E9.) from Novus Biologicals is a mouse monoclonal antibody to 5-HT1E. This antibody reacts with human. The 5-HT1E Antibody (2E9.) has been validated for the following applications: Western Blot, ELISA.
Type: Primary
Antigen: 5-HT1E
Clonality: Monoclonal
Clone: 2E9.
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human